PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_010073-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 109aa    MW: 12928.3 Da    PI: 10.8028
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_010073-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding431.1e-133075348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      W+  Ede+l+ +v ++G + W+ + ++ g+ R++k+c++rw+++l
  AHYPO_010073-RA 30 IWSSAEDEKLKAYVLEFGAKKWEDVKKRTGLLRSGKSCRLRWLNHL 75
                     5*****************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6792379IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-172678IPR009057Homeodomain-like
SMARTSM007175.0E-82777IPR001005SANT/Myb domain
CDDcd001672.87E-73175No hitNo description
SuperFamilySSF466891.31E-2031106IPR009057Homeodomain-like
PfamPF139211.7E-123189No hitNo description
Gene3DG3DSA:1.10.10.601.4E-979107IPR009057Homeodomain-like
PROSITE profilePS512947.57180109IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MDMISHTKKR RLQNVKKNLQ VGYSLKNRTI WSSAEDEKLK AYVLEFGAKK WEDVKKRTGL  60
LRSGKSCRLR WLNHLCPKLK KGHFTREEKN CIIKLYYKSG NQWSLIACK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-142710726105MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009381364.11e-26PREDICTED: transcription factor GAMYB-like
SwissprotA2WW871e-24GAM1_ORYSI; Transcription factor GAMYB
SwissprotQ0JIC21e-24GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLA0A0D9WI033e-26A0A0D9WI03_9ORYZ; Uncharacterized protein
TrEMBLM8BRZ13e-26M8BRZ1_AEGTA; Transcription factor GAMYB
STRINGSolyc07g054960.1.12e-23(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26930.13e-26myb domain protein 97